PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00030.150
Common NameJCGZ_04346, LOC105633708
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 334aa    MW: 37071.5 Da    PI: 9.487
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00030.150genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1017.5e-32134187255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Jcr4S00030.150 134 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 187
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.65E-15131188IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-28132188IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-23134187IPR006447Myb domain, plants
PfamPF002492.1E-7135186IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MRSASTLPDL SLQISPPSAS DCEAKKMAYE GVLSRKALYS DRSSTTDSGS SGSDLSHENG  60
FFSQERSYNL GPSEPTLSLG FEMTDLSHKT LPLPRNLNNH IHNHHHHHQP QIYGREFKRN  120
GRMISGVKRS IRAPRMRWTT TLHAHFVHAV QLLGGHERAT PKSVLELMNV KDLTLAHVKS  180
HLQMYRTVKS TDKGSGQGQT NTGLKQRAGI ADVDALKAEA NPSSLNPPLP PPTSPLATIQ  240
KTQIRGSWSS SMETKDKNRS NTEALAYNSH FNTHETKEDG SMEALQVSDR VKETLERSSL  300
SSSDMLVNLE FTLGRPSWKM DYAESSNELT LLKC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071737.10.0PREDICTED: probable transcription factor KAN4
TrEMBLA0A067KQD20.0A0A067KQD2_JATCU; Uncharacterized protein
STRINGVIT_18s0001g11390.t011e-132(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.12e-74G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]